PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047207
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 254aa    MW: 28581.9 Da    PI: 8.4059
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047207genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA627.1e-20187220134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +
  PGSC0003DMP400047207 187 CQHCGVDKTPQWRAGPTGPKTLCNACGVRYKSGR 220
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.4E-17181231IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.479181217IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.66E-15183244No hitNo description
Gene3DG3DSA:3.30.50.102.3E-15184218IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.37E-15186235No hitNo description
PfamPF003201.1E-17187220IPR000679Zinc finger, GATA-type
PROSITE patternPS003440187212IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MEAMYSKTCF MVDDDILNFS LDDDEKYQTS SSSFESSSTL GFHQDDHSPS FPDYVEEELE  60
WLSNKDAFPA VEFDIFSDHV PNVIFDHHSP NSVLENSSSN NNNNNNCNVN VKKNAFTSHT  120
SSLLQVPINH PVGARSKRRR RIALQCDNSC VWGNQVKFNN TSTKQGLTLL KISMTKAKRG  180
TSIGRRCQHC GVDKTPQWRA GPTGPKTLCN ACGVRYKSGR LFPEYRPANS PTFSVDLHSS  240
SHRKVLEMRK QRI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136141KRRRRI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355741.10.0PREDICTED: GATA transcription factor 1-like
TrEMBLM1CLA00.0M1CLA0_SOLTU; Uncharacterized protein
STRINGSolyc05g053500.2.11e-155(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.16e-43GATA transcription factor 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]